PDB entry 4xyf

View 4xyf on RCSB PDB site
Description: Crystal structure of c-Met in complex with (S)-5-(8-fluoro-3-(1-(3-(2-methoxyethoxy)quinolin-6-yl)ethyl)-[1,2,4]triazolo[4,3-a]pyridin-6-yl)-3-methylisoxazole
Class: TRANSFERASE/TRANSFERASE Inhibitor
Keywords: receptor tyrosine kinase, inhibitor, complex, intracellular catalytic domain
Deposited on 2015-02-02, released 2015-03-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xyfa_
  • Heterogens: 44X, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xyfA (A:)
    qntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihc
    avkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrn
    firnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglar
    dmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdv
    ntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfige
    hyvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xyfA (A:)
    hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtllkihcavkslnrit
    digevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnp
    tvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyys
    vhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyl
    lqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig