PDB entry 4xy2

View 4xy2 on RCSB PDB site
Description: Crystal structure of PDE10A in complex with ASP9436
Class: hydrolase/hydrolase inhibitor
Keywords: Phosphodiesterase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2015-02-02, released 2015-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d4xy2a1, d4xy2a2
  • Chain 'B':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d4xy2b1, d4xy2b2
  • Heterogens: ZN, MG, 490, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xy2A (A:)
    gshmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfe
    leklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchd
    ldhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvle
    iirkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpv
    tkltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqi
    lpptepllkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xy2A (A:)
    hmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
    klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
    hrgfsnsyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlaly
    fgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwa
    egdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdn
    lsqwekvirgee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xy2B (B:)
    gshmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfe
    leklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchd
    ldhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvle
    iirkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpv
    tkltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqi
    lpptepllkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xy2B (B:)
    hmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
    klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
    hrgfsnsylqkfplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
    aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
    andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
    epllkacrdnlsqwekvirgee