PDB entry 4xxp

View 4xxp on RCSB PDB site
Description: Crystal Structure of an Uncharacterized Protein (Rv0315 ortholog) from Mycobacterium paratuberculosis
Class: hydrolase
Keywords: SSGCID, hydrolase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2015-01-30, released 2015-02-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.143
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein (Rv0315 ortholog)
    Species: Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) [TaxId:262316]
    Gene: MAP_1661c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xxpa_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xxpA (A:)
    mahhhhhhaspapppaapsgqsgtylfqdefdgpagsapdaskwavakaretikdptywe
    rpenigqyrddrrnvfldgksnlvlraakngptyysgkvqslwrggvghtwearikldcl
    tagawpaywlgnddqgeidvmewygngnwpsattvhakanggewkthniavdsawhtwrc
    qwdeagirfwkdyvdgaqpyfdvpasslpdwpfngpgytvfpvfnlavagsgggdpgpgs
    ypadmlidwirvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xxpA (A:)
    ylfqdefdgpagsapdaskwavakqyrddrrnvfldgksnlvlraakngptyysgkvqsl
    wrggvghtwearikldcltagawpaywlgnddqgeidvmewygngnwpsattvhakewkt
    hniavdsawhtwrcqwdeagirfwkdyvdgaqpyfdvpasslpdwpfngpgytvfpvfnl
    avagsgggdpgpgsypadmlidwirvw