PDB entry 4xxk

View 4xxk on RCSB PDB site
Description: Crystal structure of the Semet-derivative of the Bilin-binding domain of phycobilisome core-membrane linker ApcE
Class: transferase
Keywords: phycobilisome, ApcE, phycocyanobilin attachment, TRANSFERASE
Deposited on 2015-01-30, released 2015-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 2.97 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phycobiliprotein ApcE
    Species: Nostoc sp. (strain PCC 7120 / UTEX 2576) [TaxId:103690]
    Gene: apcE, alr0020
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80559 (1-57)
      • linker (58-61)
    • Uniprot P80559 (62-148)
      • expression tag (149)
    Domains in SCOPe 2.07: d4xxka1, d4xxka2
  • Chain 'B':
    Compound: Phycobiliprotein ApcE
    Species: Nostoc sp. (strain PCC 7120 / UTEX 2576) [TaxId:103690]
    Gene: apcE, alr0020
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80559 (1-57)
      • linker (58-61)
    • Uniprot P80559 (62-End)
    Domains in SCOPe 2.07: d4xxkb_
  • Heterogens: CYC

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xxkA (A:)
    mlavatitqaeqqdrflgrgeldelasyfasgakrleiaqlltenseiivsraanrifqk
    ienmakslrdlswflryatyaivagdpniivvntrglreiienacsgeativalqeikaa
    slsyfrkdpeaaeivsqymdvlitefkaplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xxkA (A:)
    lavatitqaeqqdrflgrgeldelasyfasgakrleiaqlltenseiivsraanrifqki
    enmakslrdlswflryatyaivagdpniivvntrglreiienacsgeativalqeikaas
    lsyfrkdpeaaeivsqymdvlitefkapl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xxkB (B:)
    mlavatitqaeqqdrflgrgeldelasyfasgakrleiaqlltenseiivsraanrifqk
    ienmakslrdlswflryatyaivagdpniivvntrglreiienacsgeativalqeikaa
    slsyfrkdpeaaeivsqymdvlitefkaplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xxkB (B:)
    lavatitqaeqqdrflgrgeldelasyfasgakrleiaqlltenseiivsraanrifqki
    enmakslrdlswflryatyaivagdpniivvntrglreiienacsgeativalqeikaas
    lsyfrkdpeaaeivsqymdvlitefka