PDB entry 4xxh

View 4xxh on RCSB PDB site
Description: trehalose repressor from escherichia coli
Class: gene regulation
Keywords: laci family, phosphate binding, protein structure, trehalose repressor, gene regulation
Deposited on 2015-01-30, released 2015-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-10, with a file datestamp of 2015-06-05.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type transcriptional regulator TreR
    Species: Escherichia coli K-12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xxha_
  • Chain 'B':
    Compound: HTH-type transcriptional regulator TreR
    Species: Escherichia coli K-12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xxhb_
  • Heterogens: T6P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xxhA (A:)
    sdkvvaiivtrldslsenlavqtmlpafyeqgydpimmesqfspqlvaehlgvlkrrnid
    gvvlfgftgiteemlahwqsslvllardakgfasvcyddegaikilmqrlydqghrnisy
    lgvphsdvttgkrrheaylafckahklhpvaalpglamkqgyenvakvitpettallcat
    dtlalgaskylqeqridtlqlasvgntplmkflhpeivtvdpgyaeagrqaacqliaqvt
    grsepqqiiipatls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xxhB (B:)
    sdkvvaiivtrldslsenlavqtmlpafyeqgydpimmesqfspqlvaehlgvlkrrnid
    gvvlfgftgiteemlahwqsslvllardakgfasvcyddegaikilmqrlydqghrnisy
    lgvphsdvttgkrrheaylafckahklhpvaalpglamkqgyenvakvitpettallcat
    dtlalgaskylqeqridtlqlasvgntplmkflhpeivtvdpgyaeagrqaacqliaqvt
    grsepqqiiipatls