PDB entry 4xxa

View 4xxa on RCSB PDB site
Description: Crystal structure of a recombinant Vatairea macrocarpa seed lectin
Class: sugar binding protein
Keywords: legume, recombinant lectin, Vatairea, SUGAR BINDING PROTEIN
Deposited on 2015-01-30, released 2016-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: seed lectin
    Species: Vatairea macrocarpa [TaxId:77050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xxaa_
  • Chain 'B':
    Compound: seed lectin
    Species: Vatairea macrocarpa [TaxId:77050]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81371 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d4xxab1, d4xxab2
  • Heterogens: CA, MN, GOL, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xxaA (A:)
    masevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihi
    wddstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndsnksiq
    tvavefdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltasl
    typsnatsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlqapsdd
    snlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xxaA (A:)
    sevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiwd
    dstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndnksiqtva
    vefdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltasltyp
    snatsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlqap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xxaB (B:)
    masevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihi
    wddstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndsnksiq
    tvavefdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltasl
    typsnatsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlqapsdd
    snlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xxaB (B:)
    asevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiw
    ddstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndsniqtva
    vefdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltasltyp
    snatsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlqap