PDB entry 4xx0

View 4xx0 on RCSB PDB site
Description: CoA bound to pig GTP-specific succinyl-CoA synthetase
Class: ligase
Keywords: ligase, ATP-grasp fold
Deposited on 2015-01-29, released 2015-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Gene: SUCLG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xx0a1, d4xx0a2
  • Chain 'B':
    Compound: Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Gene: SUCLG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53590 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d4xx0b1, d4xx0b2
  • Heterogens: COA, PO4, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xx0A (A:)
    sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf
    ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr
    qgktrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqs
    lcvgiggdpfngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskp
    vvsfiagltappgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefe
    krkmllvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xx0A (A:)
    sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf
    ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr
    qgktrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqs
    lcvgiggdpfngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskp
    vvsfiagltappgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefe
    krk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xx0B (B:)
    mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
    sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
    mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
    qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
    dksenepieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggv
    kesqvyqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtn
    vheaqniltnsglpitsavdledaakkavasvtkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xx0B (B:)
    mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
    sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
    mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
    qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
    dksenepieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggv
    kesqvyqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtn
    vheaqniltnsglpitsavdledaakkavasvt