PDB entry 4xwy

View 4xwy on RCSB PDB site
Description: Crystal structure of human sepiapterin reductase in complex with an N-acetylserotinin analogue
Class: oxidoreductase
Keywords: oxidoreductase, inhibitor, complex
Deposited on 2015-01-29, released 2015-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-25, with a file datestamp of 2015-11-20.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xwya_
  • Chain 'B':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xwyb_
  • Chain 'C':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xwyc_
  • Chain 'D':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xwyd_
  • Heterogens: NDP, 43O, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xwyA (A:)
    mhhhhhhenlyfqgmegglgravclltgasrgfgrtlapllasllspgsvlvlsarndea
    lrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgd
    vskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkg
    walycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelk
    akgklvdckvsaqkllsllekdefksgahvdfydk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xwyA (A:)
    glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
    vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
    walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
    laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
    llekdefksgahvdfyd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xwyB (B:)
    mhhhhhhenlyfqgmegglgravclltgasrgfgrtlapllasllspgsvlvlsarndea
    lrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgd
    vskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkg
    walycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelk
    akgklvdckvsaqkllsllekdefksgahvdfydk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xwyB (B:)
    glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
    vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
    walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
    laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
    llekdefksgahvdfyd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xwyC (C:)
    mhhhhhhenlyfqgmegglgravclltgasrgfgrtlapllasllspgsvlvlsarndea
    lrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgd
    vskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkg
    walycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelk
    akgklvdckvsaqkllsllekdefksgahvdfydk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xwyC (C:)
    glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
    vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
    walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
    laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
    llekdefksgahvdfyd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xwyD (D:)
    mhhhhhhenlyfqgmegglgravclltgasrgfgrtlapllasllspgsvlvlsarndea
    lrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgd
    vskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkg
    walycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelk
    akgklvdckvsaqkllsllekdefksgahvdfydk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xwyD (D:)
    glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
    vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
    walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
    laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
    llekdefksgahvdfyd