PDB entry 4xwn

View 4xwn on RCSB PDB site
Description: Complex structure of catalytic domain of Clostridium Cellulovorans Exgs and Cellotetraose
Class: hydrolase
Keywords: hydrolase
Deposited on 2015-01-29, released 2015-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 2.88 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exoglucanase S
    Species: Clostridium cellulovorans [TaxId:1493]
    Gene: ExgS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4xwna_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xwnA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgriegrefaapvvpnneyvqhfkdmyakih
    nanngyfsdegipyhavetlmveapdyghettseafsyymwleamnakltgdfsgfkkaw
    dvtekyiipgetdqpsasmsnydpnkpatyaaehpdpsmypsqlqfgaavgkdplynelk
    stygtsqvygmhwlldvdnwygfggatstspvyintfqrgvqescwetvpqpckdemkyg
    grngfldlftgdsqyatqfkytnapdadaravqatyyaqlaakewgvdissyvakstkmg
    dflrysffdkyfrkvgnstqagtgydsaqyllnwyyawgggissnwswrigsshnhfgyq
    npmaawilsntsdfkpkspnaatdwnnslkrqiefyqwlqsaeggiaggasnsnggsyqa
    wpagtrtfygmgytphpvyedpgsnewfgmqawsmqrvaeyyysskdpaakslldkwakw
    acanvqfddaakkfkipaklvwtgqpdtwtgsytgnsnlhvkveaygedlgvagslsnal
    syyakalesstdaadkvayntaketsrkildylwasyqddkgiavtetrndfkrfnqsvy
    ipsgwtgkmpngdviqsgatflsirskykqdpswpnveaalangtgvdmtyhrfwgqsdi
    aiafgtygtlftdptpglkgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xwnA (A:)
    pvvpnneyvqhfkdmyakihnanngyfsdegipyhavetlmveapdyghettseafsyym
    wleamnakltgdfsgfkkawdvtekyiipgetdqpsasmsnydpnkpatyaaehpdpsmy
    psqlqfgaavgkdplynelkstygtsqvygmhwlldvdnwygfggatstspvyintfqrg
    vqescwetvpqpckdemkyggrngfldlftgdsqyatqfkytnapdadaravqatyyaql
    aakewgvdissyvakstkmgdflrysffdkyfrkvgnstqagtgydsaqyllnwyyawgg
    gissnwswrigsshnhfgyqnpmaawilsntsdfkpkspnaatdwnnslkrqiefyqwlq
    saeggiaggasnsnggsyqawpagtrtfygmgytphpvyedpgsnewfgmqawsmqrvae
    yyysskdpaakslldkwakwacanvqfddaakkfkipaklvwtgqpdtwtgsytgnsnlh
    vkveaygedlgvagslsnalsyyakalesstdaadkvayntaketsrkildylwasyqdd
    kgiavtetrndfkrfnqsvyipsgwtgkmpngdviqsgatflsirskykqdpswpnveaa
    langtgvdmtyhrfwgqsdiaiafgtygtlftd