PDB entry 4xwg

View 4xwg on RCSB PDB site
Description: Crystal Structure of LCAT (C31Y) in complex with Fab1
Class: Hydrolase/Immune system
Keywords: a-b Hydrolase Complex, esterase, acyl transferase, Hydrolase-Immune system complex
Deposited on 2015-01-28, released 2015-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylcholine-sterol acyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: LCAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04180
      • engineered mutation (30)
  • Chain 'H':
    Compound: Fab1 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XWG
  • Chain 'L':
    Compound: Fab1 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XWG (0-End)
    Domains in SCOPe 2.07: d4xwgl1, d4xwgl2
  • Heterogens: ZN, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4xwgL (L:)
    syeltqppsvsvspgqtasitcsgdklgnkftswyqrkpgqspvlviyqdtkrpsgiper
    fsgstsgntatltisgtqamdeadyycqawdsstawvfgggtklevlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xwgL (L:)
    syeltqppsvsvspgqtasitcsgdklgnkftswyqrkpgqspvlviyqdtkrpsgiper
    fsgstsgntatltisgtqamdeadyycqawdsstawvfgggtklevlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshksyscqvthegstvektvapt