PDB entry 4xvc

View 4xvc on RCSB PDB site
Description: Crystal structure of an esterase from the bacterial hormone-sensitive lipase (HSL) family
Class: hydrolase
Keywords: Esterase, HYDROLASE
Deposited on 2015-01-27, released 2015-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Esterase E40
    Species: environmental samples [TaxId:33858]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XVC (Start-316)
    Domains in SCOPe 2.07: d4xvca1, d4xvca2
  • Chain 'B':
    Compound: Esterase E40
    Species: environmental samples [TaxId:33858]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XVC (Start-316)
    Domains in SCOPe 2.07: d4xvcb1, d4xvcb2
  • Chain 'C':
    Compound: Esterase E40
    Species: environmental samples [TaxId:33858]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XVC (Start-316)
    Domains in SCOPe 2.07: d4xvcc1, d4xvcc2
  • Chain 'D':
    Compound: Esterase E40
    Species: environmental samples [TaxId:33858]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XVC (Start-316)
    Domains in SCOPe 2.07: d4xvcd1, d4xvcd2
  • Chain 'E':
    Compound: Esterase E40
    Species: environmental samples [TaxId:33858]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XVC (Start-316)
    Domains in SCOPe 2.07: d4xvce1, d4xvce2
  • Chain 'F':
    Compound: Esterase E40
    Species: environmental samples [TaxId:33858]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XVC (Start-316)
    Domains in SCOPe 2.07: d4xvcf1, d4xvcf2
  • Chain 'G':
    Compound: Esterase E40
    Species: environmental samples [TaxId:33858]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XVC (Start-316)
    Domains in SCOPe 2.07: d4xvcg1, d4xvcg2
  • Chain 'H':
    Compound: Esterase E40
    Species: environmental samples [TaxId:33858]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XVC (Start-316)
    Domains in SCOPe 2.07: d4xvch1, d4xvch2
  • Heterogens: PMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xvcA (A:)
    mgsshhhhhhssglvprgshmakspeldrvigmireraatprkttdddrrlyetmlgsmp
    ldddiqterlgvngvpaewiyapgarddqvflylhgggyvigsmrthrvmlshiaraagc
    rvlgldyrlapetpfpapvedtvaayrwllahgydpsrialggdsaggglvvaalvalry
    igeplpaagvclspwidmeatgesfttnatmdpsvnkervmsiaalylggknpqaplasp
    lyadlqglppllvqvggietllddaralttrakaagvdadlevwddmphvwqhfapilpe
    gkqaiarigeflrkqig
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xvcA (A:)
    makspeldrvigmireraatprkttdddrrlyetmlgsmpldddiqterlgvngvpaewi
    yapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapve
    dtvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmea
    tgesfttnatmdpsvnkervmsiaalylggknpqaplasplyadlqglppllvqvggiet
    llddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xvcB (B:)
    mgsshhhhhhssglvprgshmakspeldrvigmireraatprkttdddrrlyetmlgsmp
    ldddiqterlgvngvpaewiyapgarddqvflylhgggyvigsmrthrvmlshiaraagc
    rvlgldyrlapetpfpapvedtvaayrwllahgydpsrialggdsaggglvvaalvalry
    igeplpaagvclspwidmeatgesfttnatmdpsvnkervmsiaalylggknpqaplasp
    lyadlqglppllvqvggietllddaralttrakaagvdadlevwddmphvwqhfapilpe
    gkqaiarigeflrkqig
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xvcB (B:)
    makspeldrvigmireraatprkttdddrrlyetmlgsmpldddiqterlgvngvpaewi
    yapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapve
    dtvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmea
    tgesfttnatmdpsvnkervmsiaalylggknpqaplasplyadlqglppllvqvggiet
    llddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xvcC (C:)
    mgsshhhhhhssglvprgshmakspeldrvigmireraatprkttdddrrlyetmlgsmp
    ldddiqterlgvngvpaewiyapgarddqvflylhgggyvigsmrthrvmlshiaraagc
    rvlgldyrlapetpfpapvedtvaayrwllahgydpsrialggdsaggglvvaalvalry
    igeplpaagvclspwidmeatgesfttnatmdpsvnkervmsiaalylggknpqaplasp
    lyadlqglppllvqvggietllddaralttrakaagvdadlevwddmphvwqhfapilpe
    gkqaiarigeflrkqig
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xvcC (C:)
    makspeldrvigmireraatprkttdddrrlyetmlgsmpldddiqterlgvngvpaewi
    yapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapve
    dtvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmea
    tgesfttnatmdpsvnkervmsiaalylggknpqaplasplyadlqglppllvqvggiet
    llddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xvcD (D:)
    mgsshhhhhhssglvprgshmakspeldrvigmireraatprkttdddrrlyetmlgsmp
    ldddiqterlgvngvpaewiyapgarddqvflylhgggyvigsmrthrvmlshiaraagc
    rvlgldyrlapetpfpapvedtvaayrwllahgydpsrialggdsaggglvvaalvalry
    igeplpaagvclspwidmeatgesfttnatmdpsvnkervmsiaalylggknpqaplasp
    lyadlqglppllvqvggietllddaralttrakaagvdadlevwddmphvwqhfapilpe
    gkqaiarigeflrkqig
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xvcD (D:)
    makspeldrvigmireraatprkttdddrrlyetmlgsmpldddiqterlgvngvpaewi
    yapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapve
    dtvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmea
    tgesfttnatmdpsvnkervmsiaalylggknpqaplasplyadlqglppllvqvggiet
    llddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4xvcE (E:)
    mgsshhhhhhssglvprgshmakspeldrvigmireraatprkttdddrrlyetmlgsmp
    ldddiqterlgvngvpaewiyapgarddqvflylhgggyvigsmrthrvmlshiaraagc
    rvlgldyrlapetpfpapvedtvaayrwllahgydpsrialggdsaggglvvaalvalry
    igeplpaagvclspwidmeatgesfttnatmdpsvnkervmsiaalylggknpqaplasp
    lyadlqglppllvqvggietllddaralttrakaagvdadlevwddmphvwqhfapilpe
    gkqaiarigeflrkqig
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xvcE (E:)
    makspeldrvigmireraatprkttdddrrlyetmlgsmpldddiqterlgvngvpaewi
    yapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapve
    dtvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmea
    tgesfttnatmdpsvnkervmsiaalylggknpqaplasplyadlqglppllvqvggiet
    llddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4xvcF (F:)
    mgsshhhhhhssglvprgshmakspeldrvigmireraatprkttdddrrlyetmlgsmp
    ldddiqterlgvngvpaewiyapgarddqvflylhgggyvigsmrthrvmlshiaraagc
    rvlgldyrlapetpfpapvedtvaayrwllahgydpsrialggdsaggglvvaalvalry
    igeplpaagvclspwidmeatgesfttnatmdpsvnkervmsiaalylggknpqaplasp
    lyadlqglppllvqvggietllddaralttrakaagvdadlevwddmphvwqhfapilpe
    gkqaiarigeflrkqig
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xvcF (F:)
    makspeldrvigmireraatprkttdddrrlyetmlgsmpldddiqterlgvngvpaewi
    yapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapve
    dtvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmea
    tgesfttnatmdpsvnkervmsiaalylggknpqaplasplyadlqglppllvqvggiet
    llddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4xvcG (G:)
    mgsshhhhhhssglvprgshmakspeldrvigmireraatprkttdddrrlyetmlgsmp
    ldddiqterlgvngvpaewiyapgarddqvflylhgggyvigsmrthrvmlshiaraagc
    rvlgldyrlapetpfpapvedtvaayrwllahgydpsrialggdsaggglvvaalvalry
    igeplpaagvclspwidmeatgesfttnatmdpsvnkervmsiaalylggknpqaplasp
    lyadlqglppllvqvggietllddaralttrakaagvdadlevwddmphvwqhfapilpe
    gkqaiarigeflrkqig
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xvcG (G:)
    makspeldrvigmireraatprkttdddrrlyetmlgsmpldddiqterlgvngvpaewi
    yapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapve
    dtvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmea
    tgesfttnatmdpsvnkervmsiaalylggknpqaplasplyadlqglppllvqvggiet
    llddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4xvcH (H:)
    mgsshhhhhhssglvprgshmakspeldrvigmireraatprkttdddrrlyetmlgsmp
    ldddiqterlgvngvpaewiyapgarddqvflylhgggyvigsmrthrvmlshiaraagc
    rvlgldyrlapetpfpapvedtvaayrwllahgydpsrialggdsaggglvvaalvalry
    igeplpaagvclspwidmeatgesfttnatmdpsvnkervmsiaalylggknpqaplasp
    lyadlqglppllvqvggietllddaralttrakaagvdadlevwddmphvwqhfapilpe
    gkqaiarigeflrkqig
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xvcH (H:)
    makspeldrvigmireraatprkttdddrrlyetmlgsmpldddiqterlgvngvpaewi
    yapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapve
    dtvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmea
    tgesfttnatmdpsvnkervmsiaalylggknpqaplasplyadlqglppllvqvggiet
    llddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig