PDB entry 4xva

View 4xva on RCSB PDB site
Description: Crystal structure of wild type cytochrome c peroxidase
Class: oxidoreductase
Keywords: Model system, flexibility, thermodynamics, cryptic site, transient protein sites, ligand binding, OXIDOREDUCTASE
Deposited on 2015-01-26, released 2015-02-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-29, with a file datestamp of 2015-07-24.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CCP1, CCP, CPO, YKR066C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xvaa_
  • Chain 'C':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CCP1, CCP, CPO, YKR066C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xvac_
  • Chain 'E':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CCP1, CCP, CPO, YKR066C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xvae_
  • Chain 'G':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CCP1, CCP, CPO, YKR066C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xvag_
  • Heterogens: HEM, BZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xvaA (A:)
    tplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhd
    ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
    pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
    lknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
    pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xvaC (C:)
    tplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhd
    ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
    pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
    lknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
    pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xvaC (C:)
    plvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdn
    tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
    kipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthl
    knsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdp
    kylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xvaE (E:)
    tplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhd
    ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
    pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
    lknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
    pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4xvaG (G:)
    tplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhd
    ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
    pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
    lknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
    pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xvaG (G:)
    plvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdn
    tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
    kipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthl
    knsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdp
    kylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl