PDB entry 4xuw

View 4xuw on RCSB PDB site
Description: Structure of the hazelnut allergen, Cor a 8
Class: allergen
Keywords: Allergen, plant protein
Deposited on 2015-01-26, released 2015-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Non-specific lipid-transfer protein
  Species: Corylus avellana [TaxId:13451]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9ATH2 (0-91)
  Domains in SCOPe 2.06: d4xuwa_
• Chain 'B':
  Compound: Non-specific lipid-transfer protein
  Species: Corylus avellana [TaxId:13451]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9ATH2 (0-91)
  Domains in SCOPe 2.06: d4xuwb_
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4xuwA (A:)
  sltcpqikgnltpcvlylknggvlppscckgvravndasrttsdrqsacnclkdtakgia
  glnpnlaaglpgkcgvnipykispstncnnvk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4xuwB (B:)
  sltcpqikgnltpcvlylknggvlppscckgvravndasrttsdrqsacnclkdtakgia
  glnpnlaaglpgkcgvnipykispstncnnvk