PDB entry 4xum

View 4xum on RCSB PDB site
Description: PPARgamma ligand binding domain in complex with indomethacin
Class: translation
Keywords: PPARgamma, Nuclear receptor, transcription factor, NSAIDs, indomethacin, TRANSLATION
Deposited on 2015-01-26, released 2015-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xuma_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xumb_
  • Heterogens: IMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xumA (A:)
    gshmlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmge
    dkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllk
    ygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalel
    ddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkm
    tdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xumA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikkev
    airifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkd
    gvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdr
    pgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvik
    ktetdmslhpllqeiykdly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xumB (B:)
    gshmlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmge
    dkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllk
    ygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalel
    ddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkm
    tdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xumB (B:)
    esadlralakhlydsyiksfpltkakarailtgspfviydmnslmmgedkikfkhitpev
    airifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkd
    gvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdr
    pgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvik
    ktetdmslhpllqeiykdly