PDB entry 4xuk

View 4xuk on RCSB PDB site
Description: Crystal structure of hydrolase AbOPH in beta lactamase superfamily
Class: hydrolase
Keywords: beta lactamase superfamily, organophosphate, phosphotriesterase, lactonase, HYDROLASE
Deposited on 2015-01-26, released 2015-10-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative hydrolase
    Species: Acinetobacter sp. NBRC 100985 [TaxId:1071390]
    Gene: ACT4_021_01090
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7GD18 (0-290)
      • see sequence_details (69)
      • see sequence_details (273)
    Domains in SCOPe 2.06: d4xuka_
  • Chain 'B':
    Compound: Putative hydrolase
    Species: Acinetobacter sp. NBRC 100985 [TaxId:1071390]
    Gene: ACT4_021_01090
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7GD18 (0-290)
      • see sequence_details (69)
      • see sequence_details (273)
    Domains in SCOPe 2.06: d4xukb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xukA (A:)
    kqvagyyqyqagdvqitalldgtnfmspnlfkdipqqqvheilkkyyadqekgvqtsina
    flvnigkslilidsgaascfgshlgsvlsnlkasgyqpeqvdtillthlhpdhvcgiskd
    gvanfpnatvyvsndeasfwldpkqaaklpkekqanylgtvekikqaiapyqakqrfkty
    klgddiqgfkvintaghtpghfsyelktkgesivfigdivhshtvqfdrpetaieydidp
    kkavetrlkqfanfakngqtiaaphlpfpgightysadgksyqwipihfkd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xukB (B:)
    kqvagyyqyqagdvqitalldgtnfmspnlfkdipqqqvheilkkyyadqekgvqtsina
    flvnigkslilidsgaascfgshlgsvlsnlkasgyqpeqvdtillthlhpdhvcgiskd
    gvanfpnatvyvsndeasfwldpkqaaklpkekqanylgtvekikqaiapyqakqrfkty
    klgddiqgfkvintaghtpghfsyelktkgesivfigdivhshtvqfdrpetaieydidp
    kkavetrlkqfanfakngqtiaaphlpfpgightysadgksyqwipihfkd