PDB entry 4xua

View 4xua on RCSB PDB site
Description: Crystal Structure of the bromodomain of human BAZ2B in complex with E11919 BAZ2-ICR analogue
Class: transcription
Keywords: TRANSCRIPTION, bromodomain, acetylated lysine binding protein, KIAA1476, WALp4, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2015-01-25, released 2015-03-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain adjacent to zinc finger domain protein 2B
  Species: Homo sapiens [TaxId:9606]
  Gene: BAZ2B, KIAA1476
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UIF8 (2-End)
    • expression tag (0-1)
  Domains in SCOPe 2.06: d4xuaa1, d4xuaa2
• Heterogens: EDO, 43C, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4xuaA (A:)
  smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
  eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkvs
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4xuaA (A:)
  smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
  eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkv