PDB entry 4xtm

View 4xtm on RCSB PDB site
Description: Crystal structure of a recombinant Vatairea macrocarpa seed lectin complexed with GalNAc
Class: sugar binding protein
Keywords: legume, recombinant lectin, vatairea macrocarpa, GalNAc, SUGAR BINDING PROTEIN
Deposited on 2015-01-23, released 2016-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: seed lectin
    Species: Vatairea macrocarpa [TaxId:77050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xtma_
  • Heterogens: CA, MN, A2G, CIT, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xtmA (A:)
    masevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihi
    wddstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndsnksiq
    tvavefdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltasl
    typsnatsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlqapsdd
    snlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xtmA (A:)
    sevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiwd
    dstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndsnksiqtv
    avefdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltaslty
    psnatsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlq