PDB entry 4xta

View 4xta on RCSB PDB site
Description: MECHANISMS OF PPARgamma ACTIVATION BY NON-STEROIDAL ANTI-INFLAMMATORY DRUGS
Class: transcription
Keywords: Nuclear receptor, transcription factor, TRANSCRIPTION
Deposited on 2015-01-23, released 2015-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xtaa_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xtab_
  • Heterogens: DIF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xtaA (A:)
    gshmlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmge
    dkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllk
    ygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalel
    ddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkm
    tdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xtaA (A:)
    sadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkevairi
    fqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvli
    segqgfmtreflkslrkpfgmepkfefavkfnalelddsdlaifiaviilsgdrpgllnv
    kpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdl
    hpllqeiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xtaB (B:)
    gshmlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmge
    dkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllk
    ygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalel
    ddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkm
    tdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xtaB (B:)
    sadlralakhlydsyiksfpltkakarailtgktkspfviydmnslmvairifqgcqfrs
    veavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmt
    reflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiedi
    qdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdhpllqei
    ykd