PDB entry 4xt1

View 4xt1 on RCSB PDB site
Description: Structure of a nanobody-bound viral GPCR bound to human chemokine CX3CL1
Class: viral protein/signalling protein
Keywords: GPCR, chemokine, membrane protein, complex, VIRAL PROTEIN-SIGNALLING PROTEIN complex
Deposited on 2015-01-22, released 2015-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G-protein coupled receptor homolog US28
    Species: Cytomegalovirus [TaxId:10358]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: fractalkine
    Species: Homo sapiens [TaxId:9606]
    Gene: CX3CL1, FKN, NTT, SCYD1, A-152E5.2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78423 (0-End)
      • engineered mutation (8)
    Domains in SCOPe 2.07: d4xt1b_
  • Chain 'C':
    Compound: nanobody 7
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 4XT1
    Domains in SCOPe 2.07: d4xt1c_
  • Heterogens: CLR, OLC, UNL, SIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xt1B (B:)
    ehhgvtkcaitcskmtskipvallihyqqnqascgkraiiletrqhrlfcadpkeqwvkd
    amqhldrqaaaltrnggsgsgsaaalevlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xt1B (B:)
    ehhgvtkcaitcskmtskipvallihyqqnqascgkraiiletrqhrlfcadpkeqwvkd
    amqhldrq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xt1C (C:)
    gpgsqvqlvesggglvrpggslrlscaasgsiftiyamgwyrqapgkqrelvaritfggd
    tnyadsvkgrftisrdnaknavylqmnslkpedtavyycnaeetiveeadywgqgtqvtv
    ssraaahhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xt1C (C:)
    qvqlvesggglvrpggslrlscaasgsiftiyamgwyrqapgkqrelvaritfggdtnya
    dsvkgrftisrdnaknavylqmnslkpedtavyycnaeetiveeadywgqgtqvtv