PDB entry 4xsq

View 4xsq on RCSB PDB site
Description: Structure of a variable lymphocyte receptor-like protein Bf66946 from Branchiostoma floridae
Class: immune system
Keywords: Bf66946, amphioxus, leucine rich repeat, variable lymphocyte receptor, IMMUNE SYSTEM
Deposited on 2015-01-22, released 2016-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: variable lymphocyte receptor-like protein Bf66946
    Species: Branchiostoma floridae [TaxId:7739]
    Gene: BRAFLDRAFT_66946
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xsqa_
  • Chain 'B':
    Compound: variable lymphocyte receptor-like protein Bf66946
    Species: Branchiostoma floridae [TaxId:7739]
    Gene: BRAFLDRAFT_66946
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3YZ59 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d4xsqb1, d4xsqb2
  • Heterogens: EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xsqA (A:)
    mcpsackctvslygemvvacggmglteipediphravylvlkdnnitkitsysfkglrnl
    qgidlsnnkinhissaalrhlghlddidlsrneltsvseklfdfpissakaqgrrffvyl
    annpwgcdcrmawlaqelaggsktfgdrhmecatpaalagrglseipqtsfvctgrdisf
    dsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xsqA (A:)
    cpsackctvslygemvvacggmglteipediphravylvlkdnnitkitsysfkglrnlq
    gidlsnnkinhissaalrhlghlddidlsrneltsvseklfdfpissakaqgrrffvyla
    nnpwgcdcrmawlaqelaggsktfgdrhmecatpaalagrglseipqtsfvctg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xsqB (B:)
    mcpsackctvslygemvvacggmglteipediphravylvlkdnnitkitsysfkglrnl
    qgidlsnnkinhissaalrhlghlddidlsrneltsvseklfdfpissakaqgrrffvyl
    annpwgcdcrmawlaqelaggsktfgdrhmecatpaalagrglseipqtsfvctgrdisf
    dsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xsqB (B:)
    mcpsackctvslygemvvacggmglteipediphravylvlkdnnitkitsysfkglrnl
    qgidlsnnkinhissaalrhlghlddidlsrneltsvseklfdfpissakaqgrrffvyl
    annpwgcdcrmawlaqelaggsktfgdrhmecatpaalagrglseipqtsfvctgrdisf