PDB entry 4xqw

View 4xqw on RCSB PDB site
Description: X-ray structure analysis of xylanase-N44E with MES at pH6.0
Class: hydrolase
Keywords: jelly roll, hydrolase
Deposited on 2015-01-20, released 2015-09-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase 2
    Species: Hypocrea jecorina [TaxId:51453]
    Gene: xyn2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36217 (0-188)
      • conflict (42)
    Domains in SCOPe 2.08: d4xqwa_
  • Heterogens: IOD, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4xqwA (A:)
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgefvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
sgsasitvs