PDB entry 4xqo

View 4xqo on RCSB PDB site
Description: Crystal structure of hemagglutinin from Jiangxi-Donghu (2013) H10N8 influenza virus in complex with 6'-SLN
Class: viral protein
Keywords: viral protein
Deposited on 2015-01-19, released 2015-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:1458555]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xqoa_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:1458555]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xqob_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:1458555]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xqoc_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:1458555]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xqod_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:1458555]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xqoe_
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:1458555]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xqof_
  • Heterogens: NAG, SIA, GAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xqoA (A:)
    adpdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpi
    gmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgfty
    gssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihh
    psstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnit
    fshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgq
    cpkyvnrrslmlatgmrnvpeliqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xqoA (A:)
    dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
    igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
    insagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
    tqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh
    nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
    yvnrrslmlatmrnvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xqoB (B:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlninsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xqoB (B:)
    lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvtntef
    esiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyervr
    kqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xqoC (C:)
    adpdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpi
    gmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgfty
    gssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihh
    psstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnit
    fshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgq
    cpkyvnrrslmlatgmrnvpeliqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xqoC (C:)
    iclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigmlig
    tpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygssin
    sagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpsstq
    ekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfshng
    gliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpkyv
    nrrslmlatgmrnvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xqoD (D:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlninsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xqoD (D:)
    lfgaiagflengwegmvdgwyfrhqnaqgtgqaadykstqaaidqitgklnrlventefe
    siesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyervrk
    qlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4xqoE (E:)
    adpdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpi
    gmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgfty
    gssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihh
    psstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnit
    fshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgq
    cpkyvnrrslmlatgmrnvpeliqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xqoE (E:)
    dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
    igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
    insagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
    tqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh
    nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
    yvnrrslmlatgmrnvpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4xqoF (F:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlninsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xqoF (F:)
    lfgaiagflengwegmvdgwygfrhqnaqaadykstqaaidqitgklnrlvekntefesi
    esefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyervrkql
    rqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln