PDB entry 4xqd

View 4xqd on RCSB PDB site
Description: X-ray structure analysis of xylanase-WT at pH4.0
Class: hydrolase
Keywords: jelly roll, hydrolase
Deposited on 2015-01-19, released 2015-09-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase 2
    Species: Hypocrea jecorina [TaxId:51453]
    Gene: xyn2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4xqda_
  • Chain 'B':
    Compound: Endo-1,4-beta-xylanase 2
    Species: Hypocrea jecorina [TaxId:51453]
    Gene: xyn2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4xqdb_
  • Heterogens: IOD, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xqdA (A:)
    tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
    fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
    rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
    sgsasitvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xqdA (A:)
    iqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvinf
    sgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtqr
    vnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfss
    gsasitvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xqdB (B:)
    tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
    fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
    rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
    sgsasitvs