PDB entry 4xq5

View 4xq5 on RCSB PDB site
Description: Human-infecting H10N8 influenza virus retains strong preference for avian-type receptors
Class: viral protein
Keywords: viral protein
Deposited on 2015-01-19, released 2015-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:1458555]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xq5a_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:1458555]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xq5b_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:1458555]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xq5c_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:1458555]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xq5d_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:1458555]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xq5e_
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:1458555]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xq5f_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xq5A (A:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgih
    hpsstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpel
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xq5A (A:)
    dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
    igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
    insagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
    tqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh
    nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
    yvnrrslmlatgmrnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xq5B (B:)
    lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
    efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
    vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlninsgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xq5B (B:)
    lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
    efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
    vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xq5C (C:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgih
    hpsstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpel
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xq5C (C:)
    dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
    igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
    insagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
    tqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh
    nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
    yvnrrslmlatgmrnvpel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xq5D (D:)
    lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
    efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
    vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlninsgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xq5D (D:)
    lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektef
    esiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyervr
    kqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4xq5E (E:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgih
    hpsstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpel
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xq5E (E:)
    dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
    igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
    insagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
    tqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh
    nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
    yvnrrslmlatgmrnvpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4xq5F (F:)
    lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
    efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
    vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlninsgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xq5F (F:)
    lfgaiagflengwegmvdgwygfrhqnaqgtqaadykstqaaidqitgklnrlvektnte
    fesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyerv
    rkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln