PDB entry 4xq3

View 4xq3 on RCSB PDB site
Description: Crystal structure of Sso-SmAP2
Class: RNA binding protein
Keywords: Archael proteins, RNA binding protein
Deposited on 2015-01-18, released 2015-04-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Like-Sm ribonucleoprotein core
    Species: Sulfolobus solfataricus (strain 98/2) [TaxId:555311]
    Gene: Ssol_1181
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xq3a_
  • Chain 'B':
    Compound: Like-Sm ribonucleoprotein core
    Species: Sulfolobus solfataricus (strain 98/2) [TaxId:555311]
    Gene: Ssol_1181
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xq3b_
  • Chain 'C':
    Compound: Like-Sm ribonucleoprotein core
    Species: Sulfolobus solfataricus (strain 98/2) [TaxId:555311]
    Gene: Ssol_1181
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xq3c_
  • Chain 'D':
    Compound: Like-Sm ribonucleoprotein core
    Species: Sulfolobus solfataricus (strain 98/2) [TaxId:555311]
    Gene: Ssol_1181
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xq3d_
  • Chain 'E':
    Compound: Like-Sm ribonucleoprotein core
    Species: Sulfolobus solfataricus (strain 98/2) [TaxId:555311]
    Gene: Ssol_1181
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xq3e_
  • Chain 'F':
    Compound: Like-Sm ribonucleoprotein core
    Species: Sulfolobus solfataricus (strain 98/2) [TaxId:555311]
    Gene: Ssol_1181
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xq3f_
  • Chain 'G':
    Compound: Like-Sm ribonucleoprotein core
    Species: Sulfolobus solfataricus (strain 98/2) [TaxId:555311]
    Gene: Ssol_1181
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xq3g_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xq3A (A:)
    gamdmqakvenplkslrtainrivlvklkdgseyigkleqtdgtmnlvlrdcteiregts
    epvakygrvlirgsnilfisvdyetvmnsek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xq3A (A:)
    nplkslrtainrivlvklkdgseyigkleqtdgtmnlvlrdcteiregtsepvakygrvl
    irgsnilfisvdyetvmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xq3B (B:)
    gamdmqakvenplkslrtainrivlvklkdgseyigkleqtdgtmnlvlrdcteiregts
    epvakygrvlirgsnilfisvdyetvmnsek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xq3B (B:)
    enplkslrtainrivlvklkdgseyigkleqtdgtmnlvlrdcteiregtsepvakygrv
    lirgsnilfisvdyetv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xq3C (C:)
    gamdmqakvenplkslrtainrivlvklkdgseyigkleqtdgtmnlvlrdcteiregts
    epvakygrvlirgsnilfisvdyetvmnsek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xq3C (C:)
    enplkslrtainrivlvklkdgseyigkleqtdgtmnlvlrdcteiregtsepvakygrv
    lirgsnilfisvdyetv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xq3D (D:)
    gamdmqakvenplkslrtainrivlvklkdgseyigkleqtdgtmnlvlrdcteiregts
    epvakygrvlirgsnilfisvdyetvmnsek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xq3D (D:)
    kvenplkslrtainrivlvklkdgseyigkleqtdgtmnlvlrdcteiregtsepvakyg
    rvlirgsnilfisvdyetv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4xq3E (E:)
    gamdmqakvenplkslrtainrivlvklkdgseyigkleqtdgtmnlvlrdcteiregts
    epvakygrvlirgsnilfisvdyetvmnsek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xq3E (E:)
    enplkslrtainrivlvklkdgseyigkleqtdgtmnlvlrdcteiregtsepvakygrv
    lirgsnilfisvdyetv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4xq3F (F:)
    gamdmqakvenplkslrtainrivlvklkdgseyigkleqtdgtmnlvlrdcteiregts
    epvakygrvlirgsnilfisvdyetvmnsek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xq3F (F:)
    venplkslrtainrivlvklkdgseyigkleqtdgtmnlvlrdcteiregtsepvakygr
    vlirgsnilfisvdyetvmnsek
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4xq3G (G:)
    gamdmqakvenplkslrtainrivlvklkdgseyigkleqtdgtmnlvlrdcteiregts
    epvakygrvlirgsnilfisvdyetvmnsek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xq3G (G:)
    venplkslrtainrivlvklkdgseyigkleqtdgtmnlvlrdcteiregtsepvakygr
    vlirgsnilfisvdyetvmns