PDB entry 4xpi

View 4xpi on RCSB PDB site
Description: Fe protein independent substrate reduction by nitrogenase variants altered in intramolecular electron transfer
Class: oxidoreductase
Keywords: NITROGEN FIXATION, MoFe protein, nitrogenase, proton reduction, nitrogen, acetylene, hydride reduction, ATP-binding, Iron, Iron-sulfur, Metal-binding, Nucleotide-binding, Oxidoreductase, Molybdenum
Deposited on 2015-01-17, released 2015-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Gene: nifD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xpia_
  • Chain 'B':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Gene: nifK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07329 (0-521)
      • engineered mutation (96)
    Domains in SCOPe 2.06: d4xpib_
  • Chain 'C':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Gene: nifD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xpic_
  • Chain 'D':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Gene: nifK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07329 (0-521)
      • engineered mutation (96)
    Domains in SCOPe 2.06: d4xpid_
  • Heterogens: HCA, ICS, GOL, 1CL, CA, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xpiA (A:)
    gmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgc
    ayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekd
    ivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvr
    cegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrill
    eemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgp
    tktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprh
    vigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdlig
    sgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapweas
    egaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xpiA (A:)
    gmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgc
    ayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekd
    ivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvr
    cegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrill
    eemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgp
    tktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprh
    vigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdlig
    sgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xpiB (B:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvahfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xpiC (C:)
    gmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgc
    ayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekd
    ivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvr
    cegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrill
    eemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgp
    tktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprh
    vigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdlig
    sgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapweas
    egaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xpiC (C:)
    gmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgc
    ayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekd
    ivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvr
    cegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrill
    eemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgp
    tktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprh
    vigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdlig
    sgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xpiD (D:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvahfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr