PDB entry 4xod

View 4xod on RCSB PDB site
Description: Crystal structure of a FimH*DsG complex from E.coli F18
Class: cell adhesion
Keywords: type I pilus, catch-bond, cell adhesion, lectin, UPEC, bacterial adhesin, UTI, mannose
Deposited on 2015-01-16, released 2016-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: ECP_4655
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xoda1, d4xoda2
  • Chain 'B':
    Compound: FimG protein
    Species: Escherichia coli [TaxId:562]
    Gene: ECP_4654
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4xodA (A:)
facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
gavgtsavslgltanyartggqvtagnvqsiigvtfvyq

  • Chain 'B':
    No sequence available.