PDB entry 4xo7

View 4xo7 on RCSB PDB site
Description: Crystal structure of human 3-alpha hydroxysteroid dehydrogenase type 3 in complex with NADP+, 5alpha-androstan-3,17-dione and (3beta, 5alpha)-3-hydroxyandrostan-17-one
Class: oxidoreductase
Keywords: alpha-beta barrel, human 3-alpha hds3, akr, akr1c2, aldo-keto reductase, nadph, oxidoreductase
Deposited on 2015-01-16, released 2016-02-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldo-keto reductase family 1 member C2
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1C2, DDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4xo7a_
  • Chain 'B':
    Compound: Aldo-keto reductase family 1 member C2
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1C2, DDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4xo7b_
  • Heterogens: NAP, ASD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xo7A (A:)
    mdskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeq
    vglairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpv
    svkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkp
    glkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpv
    lcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidgln
    rnvryltldifagppnypfsdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xo7A (A:)
    dskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeqv
    glairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpvs
    vkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpg
    lkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvl
    calakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnr
    nvryltldifagppnypfsdey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xo7B (B:)
    mdskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeq
    vglairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpv
    svkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkp
    glkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpv
    lcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidgln
    rnvryltldifagppnypfsdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xo7B (B:)
    dskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeqv
    glairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpvs
    vkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpg
    lkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvl
    calakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnr
    nvryltldifagppnypfsdey