PDB entry 4xnq
View 4xnq on RCSB PDB site
Description: Antibody hemagglutinin Complexes
Class: Viral protein/Immune system
Keywords: Antibody, hemagglutinin, neutralization
Deposited on
2015-01-15, released
2015-07-15
The last revision prior to the SCOPe 2.05 freeze date was dated
2015-07-15, with a file datestamp of
2015-07-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: H5.3 Light chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d4xnqa1, d4xnqa2 - Chain 'B':
Compound: H5.3 heavy chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Influenza H5 HA head domain VietNam rdt mutations
Species: Influenza A virus [TaxId:1161129]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Influenza H5 HA head domain VietNam rdt mutations
Species: Influenza A virus [TaxId:1161129]
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: H5.3 heavy chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: H5.3 Light chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d4xnql1, d4xnql2 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4xnqA (A:)
yeltqppsvsvspgqtvnitcsgdtlgdkyvcwyqqkpgqspvlviyqdtkrpsgiperf
sgsnsgdtatltvsgtqamdeadyycqawdsssfvfgtgtkvtvlgqpkanptvtlfpps
seelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassylslt
peqwkshrsyscqvthegstvektvapt
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'H':
No sequence available.
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>4xnqL (L:)
yeltqppsvsvspgqtvnitcsgdtlgdkyvcwyqqkpgqspvlviyqdtkrpsgiperf
sgsnsgdtatltvsgtqamdeadyycqawdsssfvfgtgtkvtvlgqpkanptvtlfpps
seelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassylslt
peqwkshrsyscqvthegstvektvapt