PDB entry 4xnn

View 4xnn on RCSB PDB site
Description: Crystal Structure of a GH7 Family Cellobiohydrolase from Daphnia pulex
Class: hydrolase
Keywords: Cellulose 1, 4-beta-Cellobiosidase, fresh water arthropod, cellulase, Cel7, hydrolase
Deposited on 2015-01-15, released 2016-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellobiohydrolase CHBI
    Species: Daphnia pulex [TaxId:6669]
    Gene: CEL7A, DAPPUDRAFT_347598
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xnna_
  • Chain 'B':
    Compound: Cellobiohydrolase CHBI
    Species: Daphnia pulex [TaxId:6669]
    Gene: CEL7A, DAPPUDRAFT_347598
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xnnb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xnnA (A:)
    envgtqaaeeplnlpisvctapgncqteadavvldsnwrwahtttgytncytgnlwdttl
    cptpetcttncaidgvpladwsgtyggsvtgnkfnlkfvtvgpystnigartflldstkt
    ryrmfqllnreftydvdvssldcglngalyfvsmdadggaakyptnkggakygtgycdaq
    cphdvkwinglanskdwtpipgdansgkgyygnccaeldiweankqsqaftthpctpndq
    trcegvvcgdndsgdryngmcdkdgcdfasyrmndhtfygpgstfkldstkpftvvsqfi
    ttdgtdngdfkefrrfyvqngvrienskvnfpgitaydsitdemcaatkglfgdlddhkn
    kggmkqmgeamrkgmalvmsiwddhdvnmlwldsnypptgnpstpgvargpcpttsgvps
    evevtqanavvsfgnikfgpigstv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xnnB (B:)
    envgtqaaeeplnlpisvctapgncqteadavvldsnwrwahtttgytncytgnlwdttl
    cptpetcttncaidgvpladwsgtyggsvtgnkfnlkfvtvgpystnigartflldstkt
    ryrmfqllnreftydvdvssldcglngalyfvsmdadggaakyptnkggakygtgycdaq
    cphdvkwinglanskdwtpipgdansgkgyygnccaeldiweankqsqaftthpctpndq
    trcegvvcgdndsgdryngmcdkdgcdfasyrmndhtfygpgstfkldstkpftvvsqfi
    ttdgtdngdfkefrrfyvqngvrienskvnfpgitaydsitdemcaatkglfgdlddhkn
    kggmkqmgeamrkgmalvmsiwddhdvnmlwldsnypptgnpstpgvargpcpttsgvps
    evevtqanavvsfgnikfgpigstv