PDB entry 4xme

View 4xme on RCSB PDB site
Description: Crystal structure of nitrophorin 7 from Rhodnius prolixus at pH 7.8 complexed with NO
Class: transport protein
Keywords: Heme, NO transporter, OXIDOREDUCTASE, transport protein
Deposited on 2015-01-14, released 2015-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-07-29, with a file datestamp of 2015-07-24.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrophorin-7
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4xmea_
  • Heterogens: HEM, NO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xmeA (A:)
    pgecsvnvipkknldkakffsgtwyethyldmdpqatekfcfsfapresggtvkealyhf
    nvdskvsfyntgtgplesngakytakfntvdkkgkeikpadekysytvtvieaakqsali
    hiclqedgkdigdlysvlnrnknalpnkkikkalnkvslvltkfvvtkdldckyddkfls
    swqk