PDB entry 4xmb

View 4xmb on RCSB PDB site
Description: Crystal structure of 2,2'-(naphthalene-1,4-diylbis(((4-methoxyphenyl)sulfonyl)azanediyl))diacetamide bound to human Keap1 Kelch domain
Class: protein binding
Keywords: nrf2 activators, cul3, cullin3, btb, PROTEIN BINDING
Deposited on 2015-01-14, released 2015-09-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-30, with a file datestamp of 2015-09-25.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kelch-like ECH-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KEAP1, INRF2, KIAA0132, KLHL19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4xmba_
  • Heterogens: 41P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xmbA (A:)
    apkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggr
    nnspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsv
    eryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmi
    tamntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgit
    vhqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xmbA (A:)
    vgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrnns
    pdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsvery
    eperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitam
    ntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitvhq
    griyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt