PDB entry 4xlv

View 4xlv on RCSB PDB site
Description: Crystal structure of the activated insulin receptor tyrosine kinase dimer
Class: transferase
Keywords: tyrosine kinase, signal transduction, phosphoryl transfer, transferase
Deposited on 2015-01-13, released 2015-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: INSR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06213 (Start-327)
      • engineered mutation (25)
      • conflict (295)
    Domains in SCOPe 2.06: d4xlva_
  • Heterogens: ACP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xlvA (A:)
    qpdgplgplfassnpeylsasdvfpssvyvpdewevsrekitllrelgqgsfgmvyegna
    rdiikgeaetrvavktvnesaslrerieflneasvmkgftchhvvrllgvvskgqptlvv
    melmahgdlksylrslrpeaennpgrppptlqemiqmaaeiadgmaylnakkfvhrdlaa
    rncmvahdftvkigdfgmtrdiyetdyyrkggkgllpvrwmapeslkdgvfttssdmwsf
    gvvlweitslaeqpyqglsneqvlkfvmdggyldqpdncpervtdlmrmcwqfnpnmrpt
    fleivnllkddlhpsfpevsffhseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xlvA (A:)
    sasdvfpssvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvn
    esaslrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrp
    eaennpgrppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgm
    trdiyetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqgl
    sneqvlkfvmdggyldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpe
    vsffhseenk