PDB entry 4xld

View 4xld on RCSB PDB site
Description: Crystal structure of the human PPARg-LBD/rosiglitazone complex obtained by dry co-crystallization and in situ diffraction
Class: gene regulation
Keywords: nuclear receptor ligand screening, gene regulation
Deposited on 2015-01-13, released 2015-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-19, with a file datestamp of 2015-08-14.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (21-295)
      • expression tag (20)
    Domains in SCOPe 2.07: d4xlda1, d4xlda2
  • Heterogens: FMT, BRL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xldA (A:)
    mgsshhhhhhssglvprgshmqlnpesadlralakhlydsyiksfpltkakarailtgkt
    tdkspfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyak
    sipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfg
    dfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelql
    klnhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xldA (A:)
    mqlnpesadlralakhlydsyiksfpltkakarailtgktspfviydmnslmmgedkikf
    kevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslm
    nkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviils
    gdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllq
    vikktetdmslhpllqeiykdly