PDB entry 4xl8

View 4xl8 on RCSB PDB site
Description: Crystal Structure of Human Adenovirus 52 Short Fiber Knob in Complex with 2-O-Methyl-5-N-Acetylneuraminic Acid
Class: viral protein
Keywords: viral protein, sialic acid, viral attachment, fiber knob, protein carbohydrate interaction
Deposited on 2015-01-13, released 2015-01-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fiber-1
    Species: Human adenovirus 52 [TaxId:332179]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xl8a_
  • Chain 'B':
    Compound: Fiber-1
    Species: Human adenovirus 52 [TaxId:332179]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xl8b_
  • Chain 'C':
    Compound: Fiber-1
    Species: Human adenovirus 52 [TaxId:332179]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0MK70 (Start-208)
      • expression tag (15-22)
  • Heterogens: MNA, GOL, TAM, GLU, ALA, MPD, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xl8A (A:)
    mrgshhhhhhgsgsgsgiegrpyngtgsrfnssgaiafgiqtlwtpptsnpnctvytesd
    sllslcltkcgahvlgsvsltgvagtmtnmaetslaieftfddtgkllhsplvnntfsir
    qgdspasnptynalafmpnstlyarggsgeprnnyyvqtylrgnvqrpitltvtfnsaat
    gyslsfkwtavvrekfaapatsfcyiteq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xl8A (A:)
    giqtlwtpptsnpnctvytesdsllslcltkcgahvlgsvsltgvagtmtnmaetslaie
    ftfddtgkllhsplvnntfsirqgdspasnptynalafmpnstlyarggsgeprnnyyvq
    tylrgnvqrpitltvtfnsaatgyslsfkwtavvrekfaapatsfcyiteq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xl8B (B:)
    mrgshhhhhhgsgsgsgiegrpyngtgsrfnssgaiafgiqtlwtpptsnpnctvytesd
    sllslcltkcgahvlgsvsltgvagtmtnmaetslaieftfddtgkllhsplvnntfsir
    qgdspasnptynalafmpnstlyarggsgeprnnyyvqtylrgnvqrpitltvtfnsaat
    gyslsfkwtavvrekfaapatsfcyiteq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xl8B (B:)
    iqtlwtpptsnpnctvytesdsllslcltkcgahvlgsvsltgvagtmtnmaetslaief
    tfddtgkllhsplvnntfsirqynalafmpnstlyarggsgeprnnyyvqtylrgnvqrp
    itltvtfnsaatgyslsfkwtavvrekfaapatsfcyiteq
    

  • Chain 'C':
    No sequence available.