PDB entry 4xks

View 4xks on RCSB PDB site
Description: E. coli BFR variant Y45F
Class: oxidoreductase
Keywords: iron storage, diiron site, oxidoreductase
Deposited on 2015-01-12, released 2015-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABD3 (0-157)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4xksa_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABD3 (0-157)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4xksb_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABD3 (0-157)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4xksc_
  • Chain 'D':
    Compound: bacterioferritin
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABD3 (0-157)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4xksd_
  • Chain 'E':
    Compound: bacterioferritin
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABD3 (0-157)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4xkse_
  • Chain 'F':
    Compound: bacterioferritin
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABD3 (0-157)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4xksf_
  • Chain 'G':
    Compound: bacterioferritin
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABD3 (0-157)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4xksg_
  • Chain 'H':
    Compound: bacterioferritin
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABD3 (0-157)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4xksh_
  • Chain 'I':
    Compound: bacterioferritin
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABD3 (0-157)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4xksi_
  • Chain 'J':
    Compound: bacterioferritin
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABD3 (0-157)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4xksj_
  • Chain 'K':
    Compound: bacterioferritin
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABD3 (0-157)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4xksk_
  • Chain 'L':
    Compound: bacterioferritin
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABD3 (0-157)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d4xksl_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xksA (A:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndvefhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xksB (B:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndvefhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xksC (C:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndvefhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xksD (D:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndvefhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xksE (E:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndvefhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xksF (F:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndvefhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xksG (G:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndvefhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xksH (H:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndvefhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xksI (I:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndvefhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xksJ (J:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndvefhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xksK (K:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndvefhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xksL (L:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndvefhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg