PDB entry 4xki

View 4xki on RCSB PDB site
Description: Human Fibroblast Growth Factor - 1 (FGF-1) mutant S116R
Class: Growth Factor
Keywords: fibroblast growth factor FGF-1 increased heparin binding affinity, Growth Factor
Deposited on 2015-01-12, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • expression tag (0)
      • engineered mutation (122)
    Domains in SCOPe 2.07: d4xkia1, d4xkia2
  • Chain 'B':
    Compound: fibroblast growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered mutation (122)
    Domains in SCOPe 2.07: d4xkib1, d4xkib2
  • Heterogens: SO4, PO4, GOL, 2PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xkiA (A:)
    mhhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvge
    vyikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkk
    ngrckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xkiA (A:)
    mhhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvge
    vyikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkk
    ngrckrgprthygqkailflplpvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xkiB (B:)
    mhhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvge
    vyikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkk
    ngrckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xkiB (B:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    grckrgprthygqkailflplpvs