PDB entry 4xkf

View 4xkf on RCSB PDB site
Description: Crystal structure of hemagglutinin from Taiwan (2013) H6N1 influenza virus in complex with LSTa
Class: viral protein
Keywords: viral protein
Deposited on 2015-01-11, released 2015-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:119212]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4XKF
    Domains in SCOPe 2.06: d4xkfa_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:119212]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4XKF (0-End)
    Domains in SCOPe 2.06: d4xkfb_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:119212]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4XKF
    Domains in SCOPe 2.06: d4xkfc_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:119212]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4XKF (0-End)
    Domains in SCOPe 2.06: d4xkfd_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:119212]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4XKF
    Domains in SCOPe 2.06: d4xkfe_
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:119212]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4XKF (0-End)
    Domains in SCOPe 2.06: d4xkff_
  • Heterogens: NAG, SIA, GAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xkfA (A:)
    adpgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdct
    iegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfem
    fpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpily
    fwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlr
    pgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqn
    vsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xkfA (A:)
    pgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctie
    gwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfp
    kstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfw
    gvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpg
    etlnvesngnliapwyaykfvstnkgavfksdlpiencdatcqtitgvlrtnktfqnvsp
    lwigecpkyvkseslrlatglrnvpqiat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xkfB (B:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiegrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xkfB (B:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xkfC (C:)
    adpgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdct
    iegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfem
    fpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpily
    fwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlr
    pgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqn
    vsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xkfC (C:)
    gdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
    wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
    stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
    vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge
    tlnvesngnliapwyaykfvskgavfksdlpiencdatcqtitgvlrtnktfqnvsplwi
    gecpkyvkseslrlatglrnvpqiat
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xkfD (D:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiegrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xkfD (D:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4xkfE (E:)
    adpgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdct
    iegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfem
    fpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpily
    fwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlr
    pgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqn
    vsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xkfE (E:)
    pgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctie
    gwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfp
    kstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfw
    gvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpg
    etlnvesngnliapwyaykfvskkgavfksdlpiencdatcqtitgvlrtnktfqnvspl
    wigecpkyvkseslrlatglrnvpq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4xkfF (F:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiegrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xkfF (F:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqg