PDB entry 4xkd

View 4xkd on RCSB PDB site
Description: Crystal structure of hemagglutinin from Taiwan (2013) H6N1 influenza virus
Class: viral protein
Keywords: viral protein
Deposited on 2015-01-11, released 2015-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:119212]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4XKD
    Domains in SCOPe 2.07: d4xkda_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:119212]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4XKD (0-End)
    Domains in SCOPe 2.07: d4xkdb_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:119212]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4XKD
    Domains in SCOPe 2.07: d4xkdc_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:119212]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4XKD (0-End)
    Domains in SCOPe 2.07: d4xkdd_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:119212]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4XKD
    Domains in SCOPe 2.07: d4xkde_
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:119212]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4XKD (0-End)
    Domains in SCOPe 2.07: d4xkdf_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xkdA (A:)
    adpgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdct
    iegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfem
    fpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpily
    fwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlr
    pgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqn
    vsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xkdA (A:)
    pgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctie
    gwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfp
    kstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfw
    gvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpg
    etlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvs
    plwigecpkyvkseslrlatglrnvpqiat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xkdB (B:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiegrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xkdB (B:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xkdC (C:)
    adpgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdct
    iegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfem
    fpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpily
    fwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlr
    pgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqn
    vsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xkdC (C:)
    gdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
    wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
    stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
    vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge
    tlnvesngnliapwyaykfvskgavfksdlpiencdatcqtitgvlrtnktfqnvsplwi
    gecpkyvkseslrlatglrnvpqiat
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xkdD (D:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiegrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xkdD (D:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4xkdE (E:)
    adpgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdct
    iegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfem
    fpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpily
    fwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlr
    pgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqn
    vsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xkdE (E:)
    pgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctie
    gwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfp
    kstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfw
    gvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpg
    etlnvesngnliapwyaykfvskkgavfksdlpiencdatcqtitgvlrtnktfqnvspl
    wigecpkyvkseslrlatglrnvpq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4xkdF (F:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiegrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xkdF (F:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqg