PDB entry 4xk4

View 4xk4 on RCSB PDB site
Description: E. coli transcriptional regulator RUTR with dihydrouracil
Class: Transcription Regulator
Keywords: structural genomics, psi-biology, new york structural genomics research consortium, nysgrc, helix-turn-helix, transcriptional regulator, transcription regulator
Deposited on 2015-01-09, released 2015-05-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type transcriptional regulator rutR
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: rutR, ycdC, b1013, JW0998
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xk4a1, d4xk4a2
  • Chain 'B':
    Compound: HTH-type transcriptional regulator rutR
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: rutR, ycdC, b1013, JW0998
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xk4b1, d4xk4b2
  • Chain 'C':
    Compound: HTH-type transcriptional regulator rutR
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: rutR, ycdC, b1013, JW0998
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xk4c1, d4xk4c2
  • Chain 'D':
    Compound: HTH-type transcriptional regulator rutR
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: rutR, ycdC, b1013, JW0998
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xk4d1, d4xk4d2
  • Heterogens: DUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xk4A (A:)
    mtqgavkttgkrsravsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfp
    skealyiavlrqildiwlaplkafredfaplaaikeyirlklevsrdypqasrlfcmeml
    agapllmdeltgdlkalideksaliagwvksgklapidpqhlifmiwastqhyadfapqv
    eavtgatlrdevffnqtvenvqriiiegirpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xk4A (A:)
    sakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqildi
    wlaplkafredfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlka
    lideksaliagwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnq
    tvenvqriiiegirpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xk4B (B:)
    mtqgavkttgkrsravsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfp
    skealyiavlrqildiwlaplkafredfaplaaikeyirlklevsrdypqasrlfcmeml
    agapllmdeltgdlkalideksaliagwvksgklapidpqhlifmiwastqhyadfapqv
    eavtgatlrdevffnqtvenvqriiiegirpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xk4B (B:)
    sakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqildi
    wlaplkafredfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlka
    lideksaliagwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnq
    tvenvqriiiegirpr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xk4C (C:)
    mtqgavkttgkrsravsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfp
    skealyiavlrqildiwlaplkafredfaplaaikeyirlklevsrdypqasrlfcmeml
    agapllmdeltgdlkalideksaliagwvksgklapidpqhlifmiwastqhyadfapqv
    eavtgatlrdevffnqtvenvqriiiegirpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xk4C (C:)
    ravsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqi
    ldiwlaplkafredfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgd
    lkalideksaliagwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevf
    fnqtvenvqriiiegirpr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xk4D (D:)
    mtqgavkttgkrsravsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfp
    skealyiavlrqildiwlaplkafredfaplaaikeyirlklevsrdypqasrlfcmeml
    agapllmdeltgdlkalideksaliagwvksgklapidpqhlifmiwastqhyadfapqv
    eavtgatlrdevffnqtvenvqriiiegirpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xk4D (D:)
    sakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqildi
    wlaplkafredfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlka
    lideksaliagwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnq
    tvenvqriiiegirpr