PDB entry 4xk1

View 4xk1 on RCSB PDB site
Description: Crystal Structure of a Phosphoserine/phosphohydroxythreonine Aminotransferase (PSAT) from Pseudomonas aeruginosa with cofactor Pyridoxal Phosphate and bound Glutamate
Class: transferase
Keywords: SSGCID, Pseudomonas aeruginosa, Phosphoserine aminotransferase, Phosphohydroxythreonine aminotransferase, PSAT, Aminotransferase class-V, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2015-01-09, released 2015-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoserine aminotransferase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: serC, PA3167
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xk1a_
  • Chain 'B':
    Compound: phosphoserine aminotransferase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: serC, PA3167
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xk1b_
  • Heterogens: FMT, GLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xk1A (A:)
    mahhhhhhmskrafnfcagpaalpdavlqraqaelldwrgkglsvmemshrsddyvaias
    kaeqdlrdlldipsdykvlflqggasqqfaeiplnllpedgvadyidtgiwskkaieear
    rygtvnvaasakeydyfaipgqnewtltkdaayvhyasnetigglefdwipetgdvplvt
    dmssdilsrpldvsrfgliyagaqknigpsglvvvivredllgrarsvcptmlnyktaad
    ngsmyntpatyswylsglvfewlkeqggvtameqrnrakkdllyktidasdfytnpiqps
    arswmnvpfrladerldkpflegaeargllnlkghrsvggmrasiynalgldavealvay
    maefekehg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xk1A (A:)
    fnfcagpaalpdavlqraqaelldwrgkglsvmemshrsddyvaiaskaeqdlrdlldip
    sdykvlflqggasqqfaeiplnllpedgvadyidtgiwskkaieearrygtvnvaasake
    ydyfaipgqnewtltkdaayvhyasnetigglefdwipetgdvplvtdmssdilsrpldv
    srfgliyagaqknigpsglvvvivredllgrarsvcptmlnyktaadngsmyntpatysw
    ylsglvfewlkeqggvtameqrnrakkdllyktidasdfytnpiqpsarswmnvpfrlad
    erldkpflegaeargllnlkghrsvggmrasiynalgldavealvaymaefekeh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xk1B (B:)
    mahhhhhhmskrafnfcagpaalpdavlqraqaelldwrgkglsvmemshrsddyvaias
    kaeqdlrdlldipsdykvlflqggasqqfaeiplnllpedgvadyidtgiwskkaieear
    rygtvnvaasakeydyfaipgqnewtltkdaayvhyasnetigglefdwipetgdvplvt
    dmssdilsrpldvsrfgliyagaqknigpsglvvvivredllgrarsvcptmlnyktaad
    ngsmyntpatyswylsglvfewlkeqggvtameqrnrakkdllyktidasdfytnpiqps
    arswmnvpfrladerldkpflegaeargllnlkghrsvggmrasiynalgldavealvay
    maefekehg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xk1B (B:)
    fnfcagpaalpdavlqraqaelldwrgkglsvmemshrsddyvaiaskaeqdlrdlldip
    sdykvlflqggasqqfaeiplnllpedgvadyidtgiwskkaieearrygtvnvaasake
    ydyfaipgqnewtltkdaayvhyasnetigglefdwipetgdvplvtdmssdilsrpldv
    srfgliyagaqknigpsglvvvivredllgrarsvcptmlnyktaadngsmyntpatysw
    ylsglvfewlkeqggvtameqrnrakkdllyktidasdfytnpiqpsarswmnvpfrlad
    erldkpflegaeargllnlkghrsvggmrasiynalgldavealvay