PDB entry 4xjr

View 4xjr on RCSB PDB site
Description: The catalytic mechanism of human parainfluenza virus type 3 haemagglutinin-neuraminidase revealed
Class: hydrolase
Keywords: Hydrolase, Human Parainfluenza Virus 3, Haemagglutinin-Neuraminidase, sialidase mechanism
Deposited on 2015-01-09, released 2015-02-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin-neuraminidase
    Species: Human parainfluenza virus 3 [TaxId:11216]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4xjra_
  • Chain 'B':
    Compound: hemagglutinin-neuraminidase
    Species: Human parainfluenza virus 3 [TaxId:11216]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4xjrb_
  • Heterogens: CA, SO4, NAG, OEL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xjrA (A:)
    iseitirndnqevppqrithdvgikplnpddfwrctsglpslmktpkirlmpgpgllamp
    ttvdgcvrtpslvindliyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnpris
    htfnindnrkscslallntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrf
    knnnisfdqpyaalypsvgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcn
    qashspwfsdrrmvnsiivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytr
    stswhsklqlgiiditdysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdaypl
    nptgsivssvildsqksrvnpvitystatervnelairnktlsagytttscithynkgyc
    fhiveinhksldtfqpmlfkteipkscshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xjrA (A:)
    rithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvind
    liyaytsnlitrgcqdigksyqvlqigiitvnvpdlnprishtfnindnrkscslallnt
    dvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalypsvg
    pgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvnsiiv
    vdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditdys
    dirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqksrv
    npvitystatervnelairnktlsagytttscithynkgycfhiveinhksldtfqpmlf
    kteipkscs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xjrB (B:)
    iseitirndnqevppqrithdvgikplnpddfwrctsglpslmktpkirlmpgpgllamp
    ttvdgcvrtpslvindliyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnpris
    htfnindnrkscslallntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrf
    knnnisfdqpyaalypsvgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcn
    qashspwfsdrrmvnsiivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytr
    stswhsklqlgiiditdysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdaypl
    nptgsivssvildsqksrvnpvitystatervnelairnktlsagytttscithynkgyc
    fhiveinhksldtfqpmlfkteipkscshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xjrB (B:)
    ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvindl
    iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
    ntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyps
    vgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvnsi
    ivvdsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditdysdi
    rikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqksrvnp
    vitystatervnelairnktlsagytttscithynkgycfhiveinhksldtfqpmlfkt
    eipksc