PDB entry 4xjk

View 4xjk on RCSB PDB site
Description: Crystal structure of Mn(II) Ca(II) Na(I) bound calprotectin
Class: metal binding protein
Keywords: EF-hand calcium binding, Metal ion binding, Immune system process, Inflammatory response, METAL BINDING PROTEIN
Deposited on 2015-01-08, released 2015-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.07: d4xjka_
  • Chain 'B':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xjkb_
  • Chain 'C':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.07: d4xjkc_
  • Chain 'D':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xjkd_
  • Chain 'E':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.07: d4xjke_
  • Chain 'F':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xjkf_
  • Chain 'G':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.07: d4xjkg_
  • Chain 'H':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xjkh_
  • Chain 'I':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.07: d4xjki_
  • Chain 'J':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xjkj_
  • Heterogens: CA, NA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xjkA (A:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xjkA (A:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xjkB (B:)
    mtskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvie
    himedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xjkB (B:)
    kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
    edldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xjkC (C:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xjkC (C:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xjkD (D:)
    mtskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvie
    himedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xjkD (D:)
    kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
    edldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgeg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4xjkE (E:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xjkE (E:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshee
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4xjkF (F:)
    mtskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvie
    himedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xjkF (F:)
    kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
    edldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglge
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4xjkG (G:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xjkG (G:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4xjkH (H:)
    mtskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvie
    himedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xjkH (H:)
    kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
    edldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgeg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4xjkI (I:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xjkI (I:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshe
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4xjkJ (J:)
    mtskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvie
    himedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xjkJ (J:)
    kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
    edldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglge