PDB entry 4xjj

View 4xjj on RCSB PDB site
Description: Extracellular domain of type II Transforming Growth Factor Beta receptor in complex with 2-(2-Hydroxyethyl)NDSB-201
Class: Cytokine Receptor
Keywords: type II Transforming Growth Factor Beta receptor, NDSB-201, Transforming Growth Factor Beta, kinase, extracellular domain
Deposited on 2015-01-08, released 2015-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: TGF-beta receptor type-2
  Species: Homo sapiens [TaxId:9606]
  Gene: TGFBR2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P37173 (2-End)
    • expression tag (1)
    • engineered mutation (72)
  Domains in SCOPe 2.06: d4xjja1, d4xjja2
• Heterogens: 41D, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4xjjA (A:)
  malckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitletvchdpklp
  yhdfiledaasptcimkekkkpgetffmcscssdecndniifseeyntsnpd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4xjjA (A:)
  alckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitletvchdpklpy
  hdfiledaasptcimkekkkpgetffmcscssdecndniifseey