PDB entry 4xjc

View 4xjc on RCSB PDB site
Description: dCTP deaminase-dUTPase from Bacillus halodurans
Class: hydrolase
Keywords: bifunctional, TTP binding, complex, hydrolase
Deposited on 2015-01-08, released 2015-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxycytidine triphosphate deaminase
    Species: Bacillus halodurans C-125 [TaxId:272558]
    Gene: dcd, BH0368
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xjca_
  • Chain 'B':
    Compound: deoxycytidine triphosphate deaminase
    Species: Bacillus halodurans C-125 [TaxId:272558]
    Gene: dcd, BH0368
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xjcb_
  • Chain 'C':
    Compound: deoxycytidine triphosphate deaminase
    Species: Bacillus halodurans C-125 [TaxId:272558]
    Gene: dcd, BH0368
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xjcc_
  • Chain 'D':
    Compound: deoxycytidine triphosphate deaminase
    Species: Bacillus halodurans C-125 [TaxId:272558]
    Gene: dcd, BH0368
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xjcd_
  • Chain 'E':
    Compound: deoxycytidine triphosphate deaminase
    Species: Bacillus halodurans C-125 [TaxId:272558]
    Gene: dcd, BH0368
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xjce_
  • Chain 'F':
    Compound: deoxycytidine triphosphate deaminase
    Species: Bacillus halodurans C-125 [TaxId:272558]
    Gene: dcd, BH0368
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4xjcf_
  • Heterogens: TTP, MG, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xjcA (A:)
    milsgktisekltekeleitplteeqiqpasvdlrlgphfvtiddskeavisferpiryr
    ewttsdetivlpphtfllattmetvklpnhltafvegrssvgrlglfiqnagwvdpgfng
    qitlelfnanrlpielpigrricqlvfaevtgevapyqgkylfqkgatmseiykdaf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xjcB (B:)
    milsgktisekltekeleitplteeqiqpasvdlrlgphfvtiddskeavisferpiryr
    ewttsdetivlpphtfllattmetvklpnhltafvegrssvgrlglfiqnagwvdpgfng
    qitlelfnanrlpielpigrricqlvfaevtgevapyqgkylfqkgatmseiykdaf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xjcC (C:)
    milsgktisekltekeleitplteeqiqpasvdlrlgphfvtiddskeavisferpiryr
    ewttsdetivlpphtfllattmetvklpnhltafvegrssvgrlglfiqnagwvdpgfng
    qitlelfnanrlpielpigrricqlvfaevtgevapyqgkylfqkgatmseiykdaf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xjcD (D:)
    milsgktisekltekeleitplteeqiqpasvdlrlgphfvtiddskeavisferpiryr
    ewttsdetivlpphtfllattmetvklpnhltafvegrssvgrlglfiqnagwvdpgfng
    qitlelfnanrlpielpigrricqlvfaevtgevapyqgkylfqkgatmseiykdaf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xjcE (E:)
    milsgktisekltekeleitplteeqiqpasvdlrlgphfvtiddskeavisferpiryr
    ewttsdetivlpphtfllattmetvklpnhltafvegrssvgrlglfiqnagwvdpgfng
    qitlelfnanrlpielpigrricqlvfaevtgevapyqgkylfqkgatmseiykdaf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4xjcF (F:)
    milsgktisekltekeleitplteeqiqpasvdlrlgphfvtiddskeavisferpiryr
    ewttsdetivlpphtfllattmetvklpnhltafvegrssvgrlglfiqnagwvdpgfng
    qitlelfnanrlpielpigrricqlvfaevtgevapyqgkylfqkgatmseiykdaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xjcF (F:)
    milsgktisekltekeleitplteeqiqpasvdlrlgphfvtiavisferpiryrewtts
    detivlpphtfllattmetvklpnhltafvegrssvgrlglfiqnagwvdpgfngqitle
    lfnanrlpielpigrricqlvfaevtgevapyqgkylfqkgatmseiyk