PDB entry 4xj7

View 4xj7 on RCSB PDB site
Description: Crystal Structure of E112A Mutant of Stationary Phase Survival Protein (SurE) from Salmonella typhimurium soaked with AMP
Class: hydrolase
Keywords: Stationary phase survival protein, Domain swapping, Rossmann fold like, Phosphatase, HYDROLASE
Deposited on 2015-01-08, released 2015-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'/3'-nucleotidase SurE
    Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) [TaxId:99287]
    Gene: surE, STM2927
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-266)
      • expression tag (4-13)
      • engineered mutation (125)
    Domains in SCOPe 2.07: d4xj7a1, d4xj7a2
  • Chain 'B':
    Compound: 5'/3'-nucleotidase SurE
    Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) [TaxId:99287]
    Gene: surE, STM2927
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-266)
      • expression tag (8-13)
      • engineered mutation (125)
    Domains in SCOPe 2.07: d4xj7b1, d4xj7b2
  • Chain 'C':
    Compound: 5'/3'-nucleotidase SurE
    Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) [TaxId:99287]
    Gene: surE, STM2927
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-266)
      • expression tag (13)
      • engineered mutation (125)
    Domains in SCOPe 2.07: d4xj7c1, d4xj7c2
  • Chain 'D':
    Compound: 5'/3'-nucleotidase SurE
    Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) [TaxId:99287]
    Gene: surE, STM2927
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66881 (14-266)
      • expression tag (13)
      • engineered mutation (125)
    Domains in SCOPe 2.07: d4xj7d1, d4xj7d2
  • Heterogens: MG, PO4, ADN, ADE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xj7A (A:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamagrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltahsahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xj7A (A:)
    hhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltless
    lrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaa
    magrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkg
    irvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvd
    ltahsahdvvsdwldsvgvgtqw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xj7B (B:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamagrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltahsahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xj7B (B:)
    hhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtf
    tfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagr
    hlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvt
    rcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltah
    sahdvvsdwldsvgvgtqw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xj7C (C:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamagrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltahsahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xj7C (C:)
    smrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdng
    diavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhlgfp
    alavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsr
    hpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltahsahdv
    vsdwldsvgvgtqw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xj7D (D:)
    mrgshhhhhhgmasmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnslt
    lesslrtftfdngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgt
    vaaamagrhlgfpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlpla
    qvkgirvtrcgsrhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtp
    lhvdltahsahdvvsdwldsvgvgtqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xj7D (D:)
    smrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdng
    diavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamagrhlgfp
    alavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsr
    hpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltahsahdv
    vsdwldsvgvgtqw