PDB entry 4xiy

View 4xiy on RCSB PDB site
Description: Crystal structure of ketol-acid reductoisomerase from Azotobacter
Class: oxidoreductase
Keywords: Rossmann fold, KARI, OXIDOREDUCTASE
Deposited on 2015-01-08, released 2015-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-02, with a file datestamp of 2015-08-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ketol-acid reductoisomerase
    Species: Azotobacter vinelandii [TaxId:322710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xiya1, d4xiya2
  • Chain 'B':
    Compound: Ketol-acid reductoisomerase
    Species: Azotobacter vinelandii [TaxId:322710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xiyb1, d4xiyb2
  • Chain 'C':
    Compound: Ketol-acid reductoisomerase
    Species: Azotobacter vinelandii [TaxId:322710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xiyc1, d4xiyc2
  • Chain 'D':
    Compound: Ketol-acid reductoisomerase
    Species: Azotobacter vinelandii [TaxId:322710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xiyd1, d4xiyd2
  • Heterogens: MG, FE, PGE, PEG, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xiyA (A:)
    mkvyydkdcdlsiiqskkvaiigygsqghahacnlkdsgvdvyvglragsasvakaeahg
    ltvksvkdavaaadvvmiltpdefqgrlykdeiepnlkkgatlafahgfsihynqvvpra
    dldvimiapkapghtvrsefvrgggipdliavyqdasgnaknlalsyacgvgggrtgiie
    ttfkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmfe
    ggianmnysisnnaeygeyvtgpevineqsrqamrnalkriqdgeyakmfitegaanyps
    mtayrrnnaahqievvgeklrtmmpwiaankivdktkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xiyA (A:)
    mkvyydkdcdlsiiqskkvaiigygsqghahacnlkdsgvdvyvglragsasvakaeahg
    ltvksvkdavaaadvvmiltpdefqgrlykdeiepnlkkgatlafahgfsihynqvvpra
    dldvimiapkapghtvrsefvrgggipdliavyqdasgnaknlalsyacgvgggrtgiie
    ttfkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmfe
    ggianmnysisnnaeygeyvtgpevineqsrqamrnalkriqdgeyakmfitegaanyps
    mtayrrnnaahqievvgeklrtmmpwia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xiyB (B:)
    mkvyydkdcdlsiiqskkvaiigygsqghahacnlkdsgvdvyvglragsasvakaeahg
    ltvksvkdavaaadvvmiltpdefqgrlykdeiepnlkkgatlafahgfsihynqvvpra
    dldvimiapkapghtvrsefvrgggipdliavyqdasgnaknlalsyacgvgggrtgiie
    ttfkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmfe
    ggianmnysisnnaeygeyvtgpevineqsrqamrnalkriqdgeyakmfitegaanyps
    mtayrrnnaahqievvgeklrtmmpwiaankivdktkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xiyB (B:)
    mkvyydkdcdlsiiqskkvaiigygsqghahacnlkdsgvdvyvglragsasvakaeahg
    ltvksvkdavaaadvvmiltpdefqgrlykdeiepnlkkgatlafahgfsihynqvvpra
    dldvimiapkapghtvrsefvrgggipdliavyqdasgnaknlalsyacgvgggrtgiie
    ttfkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmfe
    ggianmnysisnnaeygeyvtgpevineqsrqamrnalkriqdgeyakmfitegaanyps
    mtayrrnnaahqievvgeklrtmmpwia
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xiyC (C:)
    mkvyydkdcdlsiiqskkvaiigygsqghahacnlkdsgvdvyvglragsasvakaeahg
    ltvksvkdavaaadvvmiltpdefqgrlykdeiepnlkkgatlafahgfsihynqvvpra
    dldvimiapkapghtvrsefvrgggipdliavyqdasgnaknlalsyacgvgggrtgiie
    ttfkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmfe
    ggianmnysisnnaeygeyvtgpevineqsrqamrnalkriqdgeyakmfitegaanyps
    mtayrrnnaahqievvgeklrtmmpwiaankivdktkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xiyC (C:)
    mkvyydkdcdlsiiqskkvaiigygsqghahacnlkdsgvdvyvglragsasvakaeahg
    ltvksvkdavaaadvvmiltpdefqgrlykdeiepnlkkgatlafahgfsihynqvvpra
    dldvimiapkapghtvrsefvrgggipdliavyqdasgnaknlalsyacgvgggrtgiie
    ttfkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmfe
    ggianmnysisnnaeygeyvtgpevineqsrqamrnalkriqdgeyakmfitegaanyps
    mtayrrnnaahqievvgeklrtmmpwia
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xiyD (D:)
    mkvyydkdcdlsiiqskkvaiigygsqghahacnlkdsgvdvyvglragsasvakaeahg
    ltvksvkdavaaadvvmiltpdefqgrlykdeiepnlkkgatlafahgfsihynqvvpra
    dldvimiapkapghtvrsefvrgggipdliavyqdasgnaknlalsyacgvgggrtgiie
    ttfkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmfe
    ggianmnysisnnaeygeyvtgpevineqsrqamrnalkriqdgeyakmfitegaanyps
    mtayrrnnaahqievvgeklrtmmpwiaankivdktkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xiyD (D:)
    mkvyydkdcdlsiiqskkvaiigygsqghahacnlkdsgvdvyvglragsasvakaeahg
    ltvksvkdavaaadvvmiltpdefqgrlykdeiepnlkkgatlafahgfsihynqvvpra
    dldvimiapkapghtvrsefvrgggipdliavyqdasgnaknlalsyacgvgggrtgiie
    ttfkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmfe
    ggianmnysisnnaeygeyvtgpevineqsrqamrnalkriqdgeyakmfitegaanyps
    mtayrrnnaahqievvgeklrtmmpwia