PDB entry 4xix

View 4xix on RCSB PDB site
Description: Carbonic anhydrase Cah3 from Chlamydomonas reinhardtii in complex with phosphate.
Class: lyase
Keywords: photosystem II-associated, lyase
Deposited on 2015-01-08, released 2015-02-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-11, with a file datestamp of 2015-03-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase, alpha type
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: CAH3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xixa_
  • Chain 'B':
    Compound: Carbonic anhydrase, alpha type
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: CAH3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xixb_
  • Chain 'C':
    Compound: Carbonic anhydrase, alpha type
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: CAH3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39588 (1-238)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d4xixc_
  • Chain 'D':
    Compound: Carbonic anhydrase, alpha type
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: CAH3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xixd_
  • Chain 'E':
    Compound: Carbonic anhydrase, alpha type
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: CAH3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xixe_
  • Chain 'F':
    Compound: Carbonic anhydrase, alpha type
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: CAH3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xixf_
  • Chain 'G':
    Compound: Carbonic anhydrase, alpha type
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: CAH3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4xixg_
  • Chain 'H':
    Compound: Carbonic anhydrase, alpha type
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: CAH3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39588 (1-238)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d4xixh_
  • Heterogens: ZN, 2HP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xixA (A:)
    maawnygevagpptwkgvcatgkrqspiniplntsapkvdaemgefdfaygsfekcdvln
    tghgtmqvnfpagnlafignmelellqfhfhapsehamdgrryameahlvhknkstgnla
    vlgimlepggliknpalstalevapevplakkpspkginpvmllpkkskagtrpfvhypg
    slttppcsegvdwfvfmqpikvpdsqildfmrfvgdnktyatntrplqllnsrlveyel
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xixA (A:)
    aawnygevagpptwkgvcatgkrqspiniplntsapkvdaemgefdfaygsfekcdvlnt
    ghgtmqvnfpagnlafignmelellqfhfhapsehamdgrryameahlvhknkstgnlav
    lgimlepggliknpalstalevapevplakkpspkginpvmllpkkskagtrpfvhypgs
    lttppcsegvdwfvfmqpikvpdsqildfmrfvgdnktyatntrplqllnsrlveyel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xixB (B:)
    maawnygevagpptwkgvcatgkrqspiniplntsapkvdaemgefdfaygsfekcdvln
    tghgtmqvnfpagnlafignmelellqfhfhapsehamdgrryameahlvhknkstgnla
    vlgimlepggliknpalstalevapevplakkpspkginpvmllpkkskagtrpfvhypg
    slttppcsegvdwfvfmqpikvpdsqildfmrfvgdnktyatntrplqllnsrlveyel
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xixB (B:)
    awnygevagpptwkgvcatgkrqspiniplntsapkvdaemgefdfaygsfekcdvlntg
    hgtmqvnfpagnlafignmelellqfhfhapsehamdgrryameahlvhknkstgnlavl
    gimlepggliknpalstalevapevplakkpspkginpvmllpkkskagtrpfvhypgsl
    ttppcsegvdwfvfmqpikvpdsqildfmrfvgdnktyatntrplqllnsrlveyel
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xixC (C:)
    maawnygevagpptwkgvcatgkrqspiniplntsapkvdaemgefdfaygsfekcdvln
    tghgtmqvnfpagnlafignmelellqfhfhapsehamdgrryameahlvhknkstgnla
    vlgimlepggliknpalstalevapevplakkpspkginpvmllpkkskagtrpfvhypg
    slttppcsegvdwfvfmqpikvpdsqildfmrfvgdnktyatntrplqllnsrlveyel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xixD (D:)
    maawnygevagpptwkgvcatgkrqspiniplntsapkvdaemgefdfaygsfekcdvln
    tghgtmqvnfpagnlafignmelellqfhfhapsehamdgrryameahlvhknkstgnla
    vlgimlepggliknpalstalevapevplakkpspkginpvmllpkkskagtrpfvhypg
    slttppcsegvdwfvfmqpikvpdsqildfmrfvgdnktyatntrplqllnsrlveyel
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xixD (D:)
    awnygevagpptwkgvcatgkrqspiniplntsapkvdaemgefdfaygsfekcdvlntg
    hgtmqvnfpagnlafignmelellqfhfhapsehamdgrryameahlvhknkstgnlavl
    gimlepggliknpalstalevapevplakkpspkginpvmllpkkskagtrpfvhypgsl
    ttppcsegvdwfvfmqpikvpdsqildfmrfvgdnktyatntrplqllnsrlveyel
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4xixE (E:)
    maawnygevagpptwkgvcatgkrqspiniplntsapkvdaemgefdfaygsfekcdvln
    tghgtmqvnfpagnlafignmelellqfhfhapsehamdgrryameahlvhknkstgnla
    vlgimlepggliknpalstalevapevplakkpspkginpvmllpkkskagtrpfvhypg
    slttppcsegvdwfvfmqpikvpdsqildfmrfvgdnktyatntrplqllnsrlveyel
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xixE (E:)
    aawnygevagpptwkgvcatgkrqspiniplntsapkvdaemgefdfaygsfekcdvlnt
    ghgtmqvnfpagnlafignmelellqfhfhapsehamdgrryameahlvhknkstgnlav
    lgimlepggliknpalstalevapevplakkpspkginpvmllpkkskagtrpfvhypgs
    lttppcsegvdwfvfmqpikvpdsqildfmrfvgdnktyatntrplqllnsrlveyel
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4xixF (F:)
    maawnygevagpptwkgvcatgkrqspiniplntsapkvdaemgefdfaygsfekcdvln
    tghgtmqvnfpagnlafignmelellqfhfhapsehamdgrryameahlvhknkstgnla
    vlgimlepggliknpalstalevapevplakkpspkginpvmllpkkskagtrpfvhypg
    slttppcsegvdwfvfmqpikvpdsqildfmrfvgdnktyatntrplqllnsrlveyel
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xixF (F:)
    aawnygevagpptwkgvcatgkrqspiniplntsapkvdaemgefdfaygsfekcdvlnt
    ghgtmqvnfpagnlafignmelellqfhfhapsehamdgrryameahlvhknkstgnlav
    lgimlepggliknpalstalevapevplakkpspkginpvmllpkkskagtrpfvhypgs
    lttppcsegvdwfvfmqpikvpdsqildfmrfvgdnktyatntrplqllnsrlveyel
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4xixG (G:)
    maawnygevagpptwkgvcatgkrqspiniplntsapkvdaemgefdfaygsfekcdvln
    tghgtmqvnfpagnlafignmelellqfhfhapsehamdgrryameahlvhknkstgnla
    vlgimlepggliknpalstalevapevplakkpspkginpvmllpkkskagtrpfvhypg
    slttppcsegvdwfvfmqpikvpdsqildfmrfvgdnktyatntrplqllnsrlveyel
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xixG (G:)
    aawnygevagpptwkgvcatgkrqspiniplntsapkvdaemgefdfaygsfekcdvlnt
    ghgtmqvnfpagnlafignmelellqfhfhapsehamdgrryameahlvhknkstgnlav
    lgimlepggliknpalstalevapevplakkpspkginpvmllpkkskagtrpfvhypgs
    lttppcsegvdwfvfmqpikvpdsqildfmrfvgdnktyatntrplqllnsrlveyel
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xixH (H:)
    maawnygevagpptwkgvcatgkrqspiniplntsapkvdaemgefdfaygsfekcdvln
    tghgtmqvnfpagnlafignmelellqfhfhapsehamdgrryameahlvhknkstgnla
    vlgimlepggliknpalstalevapevplakkpspkginpvmllpkkskagtrpfvhypg
    slttppcsegvdwfvfmqpikvpdsqildfmrfvgdnktyatntrplqllnsrlveyel