PDB entry 4xis

View 4xis on RCSB PDB site
Description: a metal-mediated hydride shift mechanism for xylose isomerase based on the 1.6 angstroms streptomyces rubiginosus structures with xylitol and d-xylose
Deposited on 1991-03-25, released 1992-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.135
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d4xis__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4xis_ (-)
    nyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlipf
    gssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktir
    nidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaie
    pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
    fhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwa
    saagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefd
    vdaaaargmaferldqlamdhllgarg