PDB entry 4xi3

View 4xi3 on RCSB PDB site
Description: Estrogen Receptor Alpha Ligand Binding Domain in Complex with Bazedoxifene
Class: Signaling Protein
Keywords: Estrogen Receptor, SERM, Bazedoxifene, Breast Cancer, Nuclear Hormone Receptor, Signaling Protein
Deposited on 2015-01-06, released 2016-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372 (0-End)
      • engineered mutation (66)
      • engineered mutation (230)
    Domains in SCOPe 2.07: d4xi3a_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (66)
      • engineered mutation (230)
    Domains in SCOPe 2.07: d4xi3b_
  • Chain 'C':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372 (0-End)
      • engineered mutation (66)
      • engineered mutation (230)
    Domains in SCOPe 2.07: d4xi3c_
  • Chain 'D':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372 (0-End)
      • engineered mutation (66)
      • engineered mutation (230)
    Domains in SCOPe 2.07: d4xi3d_
  • Heterogens: 29S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4xi3A (A:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsydlllemld
    ahr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xi3A (A:)
    lalsltadqmvsalldaeppilyseydpsmmglltnladrelvhminwakrvpgfvdlts
    hdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmllats
    srfrmmnlqgeefvclksiillnsgvytstlksleekdhihrvldkitdtlihlmakagl
    tlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsydlllemld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4xi3B (B:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsydlllemld
    ahr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xi3B (B:)
    alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
    fvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
    mllatssrfrmmnlqgeefvclksiillnsgvyttlksleekdhihrvldkitdtlihlm
    akagltlqqqhqrlaqlllilshirhmsnkgmehlysmknvvpsydlllemld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4xi3C (C:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsydlllemld
    ahr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xi3C (C:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvyttlksleekdhihrvldkitdtlihl
    makagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsydlllemld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4xi3D (D:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsydlllemld
    ahr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4xi3D (D:)
    lalsltadqmvsalldaeppilyseydpsmmglltnladrelvhminwakrvpgfvdlts
    hdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmllats
    srfrmmnlqgeefvclksiillnsgvekdhihrvldkitdtlihlmakagltlqqqhqrl
    aqlllilshirhmsnkgmehlysmkcknvvpsydlllem